SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa003530m|PACid:17661932 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa003530m|PACid:17661932
Domain Number 1 Region: 25-134
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.31e-26
Family Glutathione peroxidase-like 0.00034
Further Details:      
 
Domain Number 2 Region: 344-455
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.83e-24
Family Glutathione peroxidase-like 0.0011
Further Details:      
 
Domain Number 3 Region: 185-292
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000542
Family Glutathione peroxidase-like 0.00078
Further Details:      
 
Domain Number 4 Region: 489-541
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000262
Family C1-like domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ppa003530m|PACid:17661932
Sequence length 567
Sequence
MANGDEDGVVHDLFSLLSSEDRNFLVHNNADQVEISSLSGKIVGLYFSGSWCGPCRRFTP
SLVEVYQDLASKGDFEVVFISSDRDDKSFSGYFSEMPWLAIPFSDLEARKRLKELFKVRG
IPNLVIIDANGKVSTDQGTRVVMEHGVDGYPFTAEKINFLKEQEAAAKENQSLSSLLVSR
SRDYLISKDGSKVPVSELEGKMVGLYFSLHTHKPCQDFTQALLKFHEKLKEKGENFEIVL
ISLDYEEEHFKQGFQVPWLALPFKAKSCEKLARHFELENVPTLVIIGQDGKTLRPNAVEL
IEEYGIEAYPFTAEKIAELADISKAKLEEQTLESLLVAGDRNFVIEKTGSKVPVSELAGK
HIMLYFSAHWCPPCRAFMPKLIKAYNQIKAKDSAFEIIFISSDRDHSSFKEFFSTMPWLA
LPLGDPRKALVQRKFKIQGIPALVAISPNGQTLSTQARQLIQAYGADAYPFTEEHLKHLE
EKLEEEAKGWPEKVKSELHAEHELTRVLHHEYVCWCREPGSGWSFYCKECDFHLHPRCAL
SNKEGTKADAPNAMEGYICDGDVCRKV
Download sequence
Identical sequences M5XEB6
XP_007222607.1.23749 ppa003530m|PACid:17661932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]