SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa005176m|PACid:17654284 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa005176m|PACid:17654284
Domain Number 1 Region: 85-205
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.71e-19
Family alpha-D-mannose-specific plant lectins 0.0055
Further Details:      
 
Weak hits

Sequence:  ppa005176m|PACid:17654284
Domain Number - Region: 360-397
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00263
Family Pan module (APPLE domain) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ppa005176m|PACid:17654284
Sequence length 473
Sequence
MQLYLFISLSLFFTYGHSKTDISLGYQLTVAVPIEYSLGFIGRAFFMETNEITQTFKTAL
SVEAVNDKYSCSLEVFLGDVKVWNSGHHSKFYTSNICVLQLTQDGDLRLKGPKDRVGWRT
GTSGQGVKRLQILRTGNLVLLDGLGNIKWQSFNFPTDVMLWGQRLSVASRLISFPTNSTS
YYSLEIEQSRIALYLNSGKWNYSYWEFKPTKNRNIAYVQLGRKGLELFNDKQKKIAEIHP
SDHQTVQFGQPLRFLALGNRTGNLKLYFYSPSIAKFDAAFQALNTTCDLPLACKPYGICT
LSSACSCIQVLIAENETSRSGNSDCSQGISGGFCGNGKTKAEMLELKGVGSVLRGAPKIV
NVSKEACASLCLEDCNCTSALYSTAKGGMEVEECFLYGMVIGVKQVERGNELSYMVKVRK
AAHGGHGKSNLKRWVLVLVGVVDGLIILLVFGGLGYYMIKKRRKHTLPNGHNN
Download sequence
Identical sequences M5WHK8
ppa005176m|PACid:17654284 XP_007212098.1.23749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]