SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa005282m|PACid:17658770 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa005282m|PACid:17658770
Domain Number 1 Region: 98-287
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.99e-42
Family PAPS reductase-like 0.003
Further Details:      
 
Domain Number 2 Region: 357-466
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.5e-21
Family PDI-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ppa005282m|PACid:17658770
Sequence length 469
Sequence
MALAVASSSTSISGRTFSPSTPSSDLKAPPVGYFRVFDRAHGQIQSQAVTFSQRRSSVKP
VNAQSKRNESIVPLAATIVAPEAVEKVEAEDITQLAKGLENASPLEIMDKALEKFGNDIA
IAFSGAEDVALIEYAHLTGRPYRVFSLDTGRLNPETYQFFDTVEKHYGIRIEYMFPDAVE
VQALVRSKGLFSFYEDGHQECCRVRKVRPLRRALKGLRAWITGQRKDQSPGTRSEIPVVQ
VDPVFEGLDGGIGSLVKWNPVANVEGRDIWDFLRAMNVPVNSLHSKGYISIGCEPCTRSV
LPGQHEREGRWWWEDAKAKECGLHKGNIKQEEGNQSNGNGAAHSNGTATETDIFTSQNLV
TLSRTGIENLARLENRHEPWIVVLYAPWCQFCQAMEGSYIELADKLAGSGVKVGKFRADG
EQKEFAQNELQLGSFPTILFFPKHSSRPIKYPSEKRDVDSLMAFINALR
Download sequence
Identical sequences M5WFP7
XP_007211418.1.23749 XP_020418531.1.23749 ppa005282m|PACid:17658770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]