SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa005415m|PACid:17663199 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa005415m|PACid:17663199
Domain Number 1 Region: 172-459
Classification Level Classification E-value
Superfamily Kelch motif 1.7e-50
Family Kelch motif 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ppa005415m|PACid:17663199
Sequence length 462
Sequence
MGNKGRVSFQLVKLENSNNMLEGPSYLVSRELPSSCEQESKWIYNTHRVMELSNNKRPLA
DGEELTLRKACKLSDAVLGGEAVVDLNGLSLSPAKDQSNDQHHEGGNSDSSSLINQLGRD
NSISCLLRCSRSDYGSIASLNKNFRSLIRSGELYTLRRKMDIVEHWVYFSCNLLEWEAFD
PDRRRWMHLPRMTSNDCFMCSDKESLAVGTELLVFGKEITSHVIYRYSILTNTWSSGTKM
NTPRCLFGSASRGEIAILAGGCDPRGNILNSAELYNSETGTWLTLPSMNKPRKMCSGVFM
DGKFYVIGGIGVGDPKQLTSGEVYDLEKTTWTEIPNMFPGRNGGAGAAEAPAAAEAPPLL
AVVNNILYAADYAEKEVRKYDKEKNVWVAVGRLPERAVSMNGWGLAFRACGDRLIVIGGP
RVLGGGTIELNSWVPDGSSPQWDLLARKPSGSFVYNCAVMGC
Download sequence
Identical sequences M5WAH6
ppa005415m|PACid:17663199 XP_020419622.1.23749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]