SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa005856m|PACid:17660609 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa005856m|PACid:17660609
Domain Number 1 Region: 151-437
Classification Level Classification E-value
Superfamily Kelch motif 1.57e-46
Family Kelch motif 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ppa005856m|PACid:17660609
Sequence length 440
Sequence
MLEGRSCLLSRVFSSSCQPESKWPYMSYRRLEDFANGKRPLGFDGEDDQERRERKLCKLL
NCCEMVETTQSSSEQSEDQQQAGVPSDSDSLIHRIGRDNSISCLIRCSRSAYGLIACLNK
SFRSLVRTGELYKLRRQNDVIEHWIYFSCHLLEWEAFDPNQRRWMHLPRMTSNECFMCSD
KESLAVGTELLVFGKEVTSHVIFRYSVLTNSWSSGMRMNAPRCLFGSASLKEIAILAGGC
NSLGSILSSAELYNSETQTWETLPSMNKPRKMCSGVFMDEKFYVIGGIGGSDSKVLTCGE
EYDLKARTWTEIPNMSPGRTGAAGEPDMPATGEAPPLVAVVNNELYAADYADMEVRKYDK
ERRLWLTVGRLPERAVSMNGWGLAFRACGDRLIVIGGPRALGEGFIEINAWVPSEGPPQW
NLLARKQSGNFVYNCAVMGC
Download sequence
Identical sequences M5XBD9
ppa005856m|PACid:17660609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]