SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa006233m|PACid:17650138 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa006233m|PACid:17650138
Domain Number 1 Region: 262-421
Classification Level Classification E-value
Superfamily eEF1-gamma domain 4.58e-60
Family eEF1-gamma domain 0.0000434
Further Details:      
 
Domain Number 2 Region: 82-211
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.23e-29
Family Glutathione S-transferase (GST), C-terminal domain 0.004
Further Details:      
 
Domain Number 3 Region: 2-84
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.89e-16
Family Glutathione S-transferase (GST), N-terminal domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ppa006233m|PACid:17650138
Sequence length 421
Sequence
MALVLHAGNTNKNGFKALIAAEYSGVKVELVKNFEMGVSNKSPKFLEMNPIGKVPVLETP
DGPVFESNAIARYVTRLKADNPLFGSTLIEYAHVEQWIDFATLEIDANILRWLIPRIGFA
VYLPPAEEAAISALKRALTALNTHLSSNTYLVGHSVTLADIIMACNLTLGFSRLLTKKFT
SEFPHVERYFWTLVNQPNFRKILGEVKQAESVPSIQSAKKPSQAKEPTKPKDEPKKEAKK
EPAKPKLEEAVAEEEAPKPKAKNSLDLLPPSKMILDEWKRLYSNTKTNFREVAVKGFWDM
YDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKG
LWLFRGQEIPKFIIDECYDMELYDWRKVDITDEDQKERVNQMIEDQEPFEGEALLDAKCF
K
Download sequence
Identical sequences M5XX10
ppa006233m|PACid:17650138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]