SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa006757m|PACid:17656600 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa006757m|PACid:17656600
Domain Number 1 Region: 247-340
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.68e-20
Family Thioltransferase 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ppa006757m|PACid:17656600
Sequence length 396
Sequence
MGCVSSKLFKKDLIKEDVIINNGGDYVINHVVSLTSSTYGVLNLENERPIKECVAESKRA
MKSSPSREDPEVINAWELMEGLEEAIPISNSAKKSPKSRALLRGFADFDARTPFKLLNQI
GSPMKLKRFGGKENRGRVIHGLGYSPKQVLKPNNGGENSCKKALNLSPEVKGSPISAIRR
SFGSDSSRRKSFSPLFDPELVASYEKEMSEEEEQIKRMVPPSPKARKLRNSSRDSESMLR
LFEKKCPPGGENAVVVYTTTLRGIRKTFEDCNNVRSIIESHLVHVLERDISMDSGFKEEI
RGLMGTKDVKVPLVFVKGRLIGGADEIVKLEEEGKLGVLFHGIPTALVGCQGCAGMRFVM
CMECNGSCKVLDEGQKKMVKCGECNENGLIHCPICC
Download sequence
Identical sequences M5W8J8
XP_007204384.1.23749 ppa006757m|PACid:17656600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]