SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa007000m|PACid:17643247 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa007000m|PACid:17643247
Domain Number 1 Region: 66-338
Classification Level Classification E-value
Superfamily Kelch motif 1.24e-43
Family Kelch motif 0.0013
Further Details:      
 
Weak hits

Sequence:  ppa007000m|PACid:17643247
Domain Number - Region: 6-83
Classification Level Classification E-value
Superfamily F-box domain 0.000249
Family F-box domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ppa007000m|PACid:17643247
Sequence length 386
Sequence
MESVHQSIIPGLPDDLALRCLAMVSHGYHGLLETVSKTWRYLIRSLDYANYKAREEWCGN
WLFVLTEGSNNEWVAYDPEADRWHPLPKILTVHADRKHFGFSSISVGNRFFVIGGSYAPH
DPAFPHQRPFITNEVMQFDPFKKQWTNVATMLTPRSHFACSAVYGKIYVAGGRNLSCTRG
LALAEVYDPVADKWEELPPMRNPQMDCLGLSYKGKFHVLSDQVGLPDQNTSEVFSPSDGT
WRTVEDIWPFSRAMQFAVQVIGDNRVYTVVDWGESLIKTRDTEKGEWYNIGSVPSVNLPD
HSRQLEAFGYGFAALRHELYVLGGKALKWEQSGAGRFDIVKLGLVRVCNPLVKPLKWRET
RPMVGSACGTVIGCASMEEESSIFPR
Download sequence
Identical sequences M5XYF3
XP_007223086.1.23749 ppa007000m|PACid:17643247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]