SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa007163m|PACid:17641337 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa007163m|PACid:17641337
Domain Number 1 Region: 274-330
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000369
Family NQO2-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ppa007163m|PACid:17641337
Sequence length 379
Sequence
MEVSGVVSRQVPCFSGAEIDTTRSSTASFHGEFRVQGRRNFGVSLRTRRFGGQLNSGFCD
DGHVQYYHVGPRCGFKKEKEIKKKLKLLKGLSKDLSASSQMGFGPLDYQKGLVAQFQEKL
ISEDAEALLLKQLEQLRAEEKELKRKRKEEKARLKAERMKNMVDSESSSSSSSESSESEC
GELVDMNRLRSEAPAKPILDSLQPFNHQEGAVLTLPSSLAIATHQENTTVEHVTEFGISQ
NQEAECCSGTSTSCVSSSGSIGHNDALSSSVMGASALKIEVCMGNKCKKSGGGALLEEFE
RVMGVEGTVVGCKCMGKCKNGPNIRVSNTVGGIQSEGTDDSVRVPTNPLYIGVGLEDVSL
IVANLIGEDNEDLGLVPAA
Download sequence
Identical sequences M5XS92
XP_007223219.1.23749 ppa007163m|PACid:17641337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]