SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa007792m|PACid:17656640 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa007792m|PACid:17656640
Domain Number 1 Region: 75-338
Classification Level Classification E-value
Superfamily Kelch motif 1.19e-39
Family Kelch motif 0.0032
Further Details:      
 
Weak hits

Sequence:  ppa007792m|PACid:17656640
Domain Number - Region: 3-45
Classification Level Classification E-value
Superfamily F-box domain 0.000759
Family F-box domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ppa007792m|PACid:17656640
Sequence length 355
Sequence
MVLISGLPDDIAYDCLIRIQYDQFPAMASVCKGWKAEVQLPEFHRLRKAGGHSQKLIVMV
QSHVVSNHGVGVFKCPDSPVYRLTLCEPDLGNWSELPPLAGFATGLPMFCQLTAVGSDLV
VIGGWDPMSWTISNSVFVFNFVSATWRRGADMPGGARIFFGCSSDSDRMVFVAGGHDDEK
NALRSAIAYDVAKDEWISLPDMARERDECKAIFQHGKLHVIGGYCTEMQGRFERSTETFN
FSTWQWDQVQDDFLLVATCPRTCVDGDDETMYMCRGGDVVKHRRGTWKFVAKLPAQVRNP
ACVTAWQGKVLVIGCAGFGEPHMAYILHLDNYTWTKLETPHKYSGHVQSSCHLEI
Download sequence
Identical sequences M5WSY7
ppa007792m|PACid:17656640 XP_007215610.1.23749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]