SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa008334m|PACid:17665242 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa008334m|PACid:17665242
Domain Number 1 Region: 176-332
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.94e-28
Family Thioltransferase 0.00074
Further Details:      
 
Domain Number 2 Region: 65-168
Classification Level Classification E-value
Superfamily TPR-like 1.38e-22
Family Tetratricopeptide repeat (TPR) 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ppa008334m|PACid:17665242
Sequence length 336
Sequence
MDKVDEDMSDTKDHFDAKRPDPCRDNDEEIVESDIELDATDVVEPDNDPPQKMGNPSVEV
TEEMQDAAQIEKSKALDAISEGKLDEAIDHITEAIMLNPTSAILKATRASVFVKLNKPNA
AIRDANAALEINPDSAKGYKIRGMAKAMLGHWEEAASDLNVASKLDYDGEIGLVLKKVEP
NVRKIEEHRRKYERLHKEREIKSAERERKRQAEARERDALSALKDGEVIGIHSAKELETK
LNAASRTLRLAILYFTTKWCGACRVISPLYTSLAGKYPKAVFLKVDIDEARDVAADWNIG
SVPAFFFVRNGKEVDKMVGADKTALEGKIAQHAGST
Download sequence
Identical sequences M5XKC3
XP_007218276.1.23749 XP_007218331.2.23749 ppa008334m|PACid:17665242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]