SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa009087m|PACid:17647969 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa009087m|PACid:17647969
Domain Number 1 Region: 173-303
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.55e-24
Family Glutathione S-transferase (GST), C-terminal domain 0.0015
Further Details:      
 
Domain Number 2 Region: 90-178
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.91e-17
Family Glutathione S-transferase (GST), N-terminal domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ppa009087m|PACid:17647969
Sequence length 307
Sequence
MAILNVSLRGTAASTSSSSLPSWPHLSNSVPFSLSNKPVIAKFPNTTILSPPKLRLQASF
GKKTRASLSATMATGGQEVLPPALTSTSDPPPLFDGKTRLYISYQCPYAQRAWISRNCKG
LEENIQLVPIDLQDRPAWYKEKVYPPNKVPSLEHNNEVKGESLDLIRYIDSHFEGPSLFP
DDPAKREFAEELLSYTDSFNKSVFASFKEDGTKAAGAAFDYIETALSKFEDGPFFLGTFS
LVDIAYAPFLERFQPFSLEVKKYDITAGRPKLAAWFEEMNKNLAYKKTRRDPKELVESYK
RRFLAQK
Download sequence
Identical sequences M5XLK4
XP_007218731.1.23749 ppa009087m|PACid:17647969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]