SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa009199m|PACid:17647425 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa009199m|PACid:17647425
Domain Number 1 Region: 169-245
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000213
Family Eukaryotic type KH-domain (KH-domain type I) 0.002
Further Details:      
 
Domain Number 2 Region: 267-298
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000432
Family CCCH zinc finger 0.0014
Further Details:      
 
Domain Number 3 Region: 102-134
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000034
Family CCCH zinc finger 0.0024
Further Details:      
 
Domain Number 4 Region: 39-64
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000641
Family CCCH zinc finger 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ppa009199m|PACid:17647425
Sequence length 302
Sequence
MDFGGGRKRGRLEAASFNGNGGFKKSKPEMESFTTGIGSKSKPCTKFFSTSGCPFGEGCH
FLHYVPGGIKAVSQMTGSNPTLPPPPRNSAAPPSFPDGSSPPSVKTRLCNKYNTVEGCKF
GDKCHFAHGEWELGRPTAQSYEDPRGGGGYPGRMGGGRMEPPQQTHGAAARFGATATAKI
SVDASLAGAIIGKNGVNSKQICRVTGAKLSIREHESDPKLRNIELEGTFDQIKDASAMVR
ELIVNVSSAAGPHMRNNPGMAASAPASNFKTKLCENFTKGTCTFGDRCHFAHGPEELRRQ
GM
Download sequence
Identical sequences M5WJ43
XP_007205631.1.23749 ppa009199m|PACid:17647425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]