SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa009316m|PACid:17667002 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa009316m|PACid:17667002
Domain Number 1 Region: 171-264
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.99e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 
Domain Number 2 Region: 262-293
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000353
Family CCCH zinc finger 0.0014
Further Details:      
 
Domain Number 3 Region: 100-131
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000183
Family CCCH zinc finger 0.0024
Further Details:      
 
Domain Number 4 Region: 37-62
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000072
Family CCCH zinc finger 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ppa009316m|PACid:17667002
Sequence length 297
Sequence
MMDTRKRGRHEAGAFHANGGFKKNKQELESFSTGVGSKSKPCTKFFSTAGCPFGESCHFL
HYVPGGYNAVAQMMNLAPAPQASRNIAPPPSNSNGSSSSAVKSRLCNKYNSAEGCKFGDK
CHFAHGEWELGKHLAQSHDDPRAMGPGPGRMTNWMEPPLAGPASSFGASSTAKISVDASL
AGAIIGKGGVNSKQICRQTGAKLSIREHESDPNLRNIELEGTFEQIQQASAMVRELIVTV
SMSGPAKTPGGGAPGAPAPPGSNYKTKLCDNFTKGTCTFGDRCHFAHGAAELRKSGM
Download sequence
Identical sequences M5W9V3
ppa009316m|PACid:17667002 XP_007202376.1.23749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]