SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa009409m|PACid:17659008 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa009409m|PACid:17659008
Domain Number 1 Region: 4-280
Classification Level Classification E-value
Superfamily Ribosome inactivating proteins (RIP) 2.88e-55
Family Plant cytotoxins 0.0000574
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ppa009409m|PACid:17659008
Sequence length 294
Sequence
MILSFSTKNATPETYRDFIQALRDQLTAGRPTSNGIPVLPRREDVPDAQRFLLVDLTNSQ
GNTIRLAIDVVNAYVVGYAADGRAYLLQENARDNRPPIHTLFRDATTRIDLGFDGSYSGL
SRVAREAVERNTPRNRARNRAGASAHDNTPVLEQIPMGRNELDTAISLLRSASSPTNQAL
GFIVIIQMLSEAARFRAIEGLVRTTMRETYDPLMRGLAMESLETHWSDLSEQIQRAQQRN
ETGFDRTIVLHNVGNERREVNSVDSPFVRGVAMLLYDRNGNCNPGSGPHRHDEL
Download sequence
Identical sequences M5XS34
ppa009409m|PACid:17659008 XP_007223159.1.23749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]