SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa009790m|PACid:17641765 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa009790m|PACid:17641765
Domain Number 1 Region: 163-271
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.18e-19
Family Thioltransferase 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ppa009790m|PACid:17641765
Sequence length 277
Sequence
MAAVTLVLNELQSDVTSANLTVPAGSNSPGVFYSVGLVRPCGSRYPPATNPVRRRYFPCG
QTLPSAVTSNPLSTVLNNPKSTVAFSFCSACPWASRDPPTSPELKISILSFRLRGPTRYP
SSSNPLVFSRKFDEIRRPIRAVNALSQEGSLQELDDTPVSVALVPISGETQFDRVMAQAQ
QLEESVVVVWMASWCRKCIYLKPKLEKLAAEYYPRLWFYSVDVNSVPHKLVARAEVTKMP
TIQLWKDGKKQAEVIGGHKAYLVVNEVRDMIENEDDT
Download sequence
Identical sequences M5X258
ppa009790m|PACid:17641765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]