SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa009830m|PACid:17656970 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa009830m|PACid:17656970
Domain Number 1 Region: 125-217
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.45e-23
Family Thioltransferase 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ppa009830m|PACid:17656970
Sequence length 275
Sequence
MADLENRLELSGKPKPTALFFNRSLSMYPTPMDAPKKPHFHASLDHHTNSFKKFYNSIET
VRSASSSFKGKVKKLCSFFESDKPGSRNPDESQSLMNVKLRPSKSMAPSKSIAPDFRILS
IRLPGTDDRIVVYFTSLRGIRRTYEDCYAVRMIFKGFGVWVDERDISMDSAYRKELQSVL
GEKNVSLPQVFIRGKYVGGAEVIKQLFETGELAKILQGIPIRKPGFVCEGCGDARFVPCM
NCSGSRKVFDEDEGMLKRCPECNENGLTRCRDCSS
Download sequence
Identical sequences M5XES8
ppa009830m|PACid:17656970 XP_007218804.1.23749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]