SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa010087m|PACid:17654882 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa010087m|PACid:17654882
Domain Number 1 Region: 76-190
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000549
Family Glutathione peroxidase-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ppa010087m|PACid:17654882
Sequence length 265
Sequence
MALISPQILTLKSPSTPSLPSHSSLIAPSQSPSFSPPNTPRSPSLFCSPKSTTQYSSRRL
VVSRASTNASALDFSPSIGEVLGDVSIFTAAGDSVQFKDLWDLNEGVAVVALLRHFGCPC
CWELASALKESKARFDSAGVKIIAVGVGSPDKARILAERLPFPMDSLYADPDRKAYNVLG
LYYGLGRTFFNPASAKVFSRFEALQKAVKNYTIEATPDDRSSVLQQGGMFVFKGKQLLYA
RKDEGTGDHAPLDDILDVCCKVPVS
Download sequence
Identical sequences M5W0P5
ppa010087m|PACid:17654882 XP_007205732.1.23749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]