SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa010584m|PACid:17646290 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa010584m|PACid:17646290
Domain Number 1 Region: 86-242
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.47e-61
Family Glutathione peroxidase-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ppa010584m|PACid:17646290
Sequence length 244
Sequence
MASMPFSATFSTPLHGYSQTKTTRSSNSSASCPSMAFWAPSVKSSLGSSKSAIFQNGFSL
QSPSFNGVFFKARSLGVYARAATEKTLYDFSVKDIDGKDVPLSKFKGKVLLIVNVASKCG
LTSSNYSELSHLYEKYKTQGFEILAFPCNQFGGQEPGSNPEIKQFACTRFKAEFPIFDKV
DVNGPSTAPVYQFLKSSAGGFLGDLVKWNFEKFLVDKNGKVVERYPPTTSPFQIERDIQK
LVAA
Download sequence
Identical sequences M5XTR8
XP_007223774.1.23749 ppa010584m|PACid:17646290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]