SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa010853m|PACid:17652295 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa010853m|PACid:17652295
Domain Number 1 Region: 100-223
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.72e-39
Family NQO2-like 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ppa010853m|PACid:17652295
Sequence length 233
Sequence
MSSYLQNIPAQLQIGSLIAIKISHQWKFRFVGSPKALSFSRSASVVASCVRSCSKMLARL
ASNRLHEIRRIFSQPARSFSTALNYHLDSPDNNPDLPWEFNEANKQKAKEILSHYPSNYK
QSAVIPLLDLAQQQHGGWLPVSAMNAVAKVIEVAPIRVYEVATFYSMFNRTKVGKYHLLV
CGTTPCMIRGSRDIEAALLNHLGVKRNEVTKDGLFSVGEMECMLCECSHDYGR
Download sequence
Identical sequences M5X5X6
ppa010853m|PACid:17652295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]