SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa010963m|PACid:17661734 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa010963m|PACid:17661734
Domain Number 1 Region: 68-227
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.88e-35
Family Glutathione peroxidase-like 0.00000668
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ppa010963m|PACid:17661734
Sequence length 229
Sequence
MAASLTISRLLAAPKSLSLSTTAPKSSLFSPKSFSSKLSYTPLPLKHYPHPKPLLRFSTT
AKPTISATIAVGDKLPEATLSYLDAAGDVQTVTLSELTKSKKAVLFAVPGAFTPTCSLKH
VPGFVEKSAELKAKGVDTIACIAVNDAFVIKAWKESLKIGDEVLLLSDGNGDFTRAIGAE
LDLSDKPVGLGVRSRRYSLLAEDGVVKVLNLEEGGAFTSSGAEDILKVL
Download sequence
Identical sequences M5WAA0
ppa010963m|PACid:17661734 XP_007202526.1.23749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]