SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa011289m|PACid:17640807 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa011289m|PACid:17640807
Domain Number 1 Region: 11-214
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.24e-33
Family PDI-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ppa011289m|PACid:17640807
Sequence length 216
Sequence
MAGGSAAKKLIQIDIVSDTVCPWCFVGKKNLDKALEASRDRYDFEVRWHPFQLNPNAPKE
GVDKKRYYEEKFGSGMSGRMESRMSEIFRGHGLEYNLSGLTGNTLDSHRLIYFAGLQGHE
KQHELVGELFLGYFTQEKYIGDREFLLESARKIGVEGAAEFLEDPNNGLNEVNEELKKYT
KDINGVPHFLINNGKQELSGGQPPEVFLRAFEAATK
Download sequence
Identical sequences M5XDH5
ppa011285m|PACid:17640806 ppa011289m|PACid:17640807 ppa011302m|PACid:17640808 XP_007215951.1.23749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]