SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa011473m|PACid:17652984 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa011473m|PACid:17652984
Domain Number 1 Region: 93-179
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000171
Family Txnl5-like 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ppa011473m|PACid:17652984
Sequence length 209
Sequence
MVALEILPSNLSINQGRGRSRCGSLYVYIYPPSLGLAAQVIYLPCTIRSTKKMQEGKHRI
LMLLQTAWVLLVVFVLKGCAQNLPPAKYDGFVYDHHLVDSDSILIEAFFDPVCPDSRDAW
PPLKKALQHYSPRVSVVVHLLPLPYHDNAFVSSRVLHIVNQLNTSATFPLLEWFFKNQVN
THWFVYSIFKFFLGANSVLHFSFAALIRH
Download sequence
Identical sequences M5XSM9
ppa011473m|PACid:17652984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]