SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa011517m|PACid:17650282 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa011517m|PACid:17650282
Domain Number 1 Region: 98-179
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000106
Family PDI-like 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ppa011517m|PACid:17650282
Sequence length 207
Sequence
MGSTPKHPLFCLTWPWDMNQNAKANTPSACNFEGPWLFKSLQTIGSIAFNFVNSVSGSSF
SLANTFMPSQLDARTSQRNSLKSKTILGPEEQGEAEHRAFASALASGKEATVVEFYSPKC
GLCNSLLNFVREVEGRNSDWLNIVMADAENYKWLPELLHYDVRYVPCFVLVDKKGRALAK
TGIPSSRLHVIAGLSHLLKMKRPCKKQ
Download sequence
Identical sequences M5XET7
ppa011517m|PACid:17650282 XP_007223438.1.23749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]