SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa011667m|PACid:17658241 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa011667m|PACid:17658241
Domain Number 1 Region: 58-186
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.49e-27
Family Glutathione peroxidase-like 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ppa011667m|PACid:17658241
Sequence length 201
Sequence
MASTLLKRASYSAMKSVAGGFQMGAQSRAYAAVAAGTDIVSAAPNVSLQKARTWDEGVSS
NFATTPLKDIFKDKKVVIFGLPGAFTGVCSQQHVPSYKKQIDKFKAKGIDSVICVAVNDP
YVMNGWANKLEATDAIEFYGDFDGSFHKSLELDKDLSGALLGPRSQRWSAYVVDGKVKVL
NVEEVPSDFKVSGGDVILGQI
Download sequence
Identical sequences M5XGR6
XP_007223472.1.23749 ppa011667m|PACid:17658241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]