SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa011681m|PACid:17667831 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa011681m|PACid:17667831
Domain Number 1 Region: 41-198
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.3e-62
Family Glutathione peroxidase-like 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ppa011681m|PACid:17667831
Sequence length 200
Sequence
MHLLKFTNWVSLFVLGFAFLYFYYAYQFSSSQIMAEGSSKSIYDFTVKDIHGNDVKLSEY
GGKVLLIVNVASQCGLTQSNYKELSVLYEKYKNKGFEILAFPCNQFGGQEPGNNEEIQEV
ACTRFKAEFPIFDKIEVNGKNEAPLYKFLKLQKGGLFGNGIKWNFTKFLVNKEGKVVERY
APVTSPLKIEKDIQSLLESS
Download sequence
Identical sequences M5XGS1
ppa011681m|PACid:17667831 ppa011682m|PACid:17667830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]