SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa011915m|PACid:17660853 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa011915m|PACid:17660853
Domain Number 1 Region: 84-191
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.16e-38
Family Thioltransferase 0.0000784
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ppa011915m|PACid:17660853
Sequence length 191
Sequence
MATVLDSLVVPRSSALPSSAALSPIAAASSVSSLSGRSGLRHYRGLKVGSALRTRSIGSL
SYGPAAGGARHRRGGLVVCEAQDTAVEVPPVTDATWQSLVLESDSPVLVEFWAPWCGPCR
MIHPIIDELAKQYAGKLKCYKVNTDEGAAIATQYGIRSIPTVIIFKGGEKKDAVIGAVPK
STLTTSIEKFL
Download sequence
Identical sequences M5WVD9
ppa011915m|PACid:17660853 XP_007212109.1.23749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]