SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa012220m|PACid:17645638 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa012220m|PACid:17645638
Domain Number 1 Region: 76-175
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.73e-34
Family Thioltransferase 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ppa012220m|PACid:17645638
Sequence length 179
Sequence
MWSVGAFNSITITPPSASFVVNKVPINTPTSLRLHYFCRPLRPLRSFSLSNHSSFGPQLS
YKRTFSFRCSAALTPELKNTLDKVVTSHKVVLFMKGTRDFPQCGFSNTVVQILKSLNVPF
ETINILENELLRQGLKEYSSWPTFPQLYVEGEFFGGCDITVEAYKTGELQELLEKAMCS
Download sequence
Identical sequences A0A140B485 M5W0E8
ppa012220m|PACid:17645638 XP_007205990.1.23749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]