SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa012298m|PACid:17667131 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa012298m|PACid:17667131
Domain Number 1 Region: 60-173
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.75e-29
Family Thioltransferase 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ppa012298m|PACid:17667131
Sequence length 175
Sequence
MAASTFHCSTSLRSRALQNPMLSPFLSHSHLNPSPNLSFPFRLQPKRGLIGLPNAPPRSL
TIFSLRESKAAAVTGDSWEKSVINSETPVLVEFYASWCGPCRMVHRVIDEIAVEYAGKLK
CFVLNTDVDLQVAEDNEIKAVPVVLLFKNGKKCDTVVGTMPKEFYVAAIERVLKS
Download sequence
Identical sequences M5W226
ppa012298m|PACid:17667131 XP_007199631.1.23749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]