SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa012405m|PACid:17658440 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa012405m|PACid:17658440
Domain Number 1 Region: 62-162
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.95e-32
Family Thioltransferase 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ppa012405m|PACid:17658440
Sequence length 170
Sequence
MSRPLSKLLFKGISGFPAACSSKIVSGSFYQNGMRYSTSVPNDSDTHDDFKPANKFDGSG
LSLKELVEQDVKDNPVMLYMKGVPEVPQCGFSSLAVRVLKQYAVPLSARNILEDPELKTA
VKAFSHWPTFPQIFIKGEFIGGSDIILNMHQSGELKEKLKDIAVNQEKSA
Download sequence
Identical sequences A0A140B4A4 M5VNI6
XP_007201252.1.23749 XP_007201253.1.23749 ppa012405m|PACid:17658440 ppa012432m|PACid:17658441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]