SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa013155m|PACid:17646628 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa013155m|PACid:17646628
Domain Number 1 Region: 57-135
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000416
Family Glutathione S-transferase (GST), N-terminal domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ppa013155m|PACid:17646628
Sequence length 137
Sequence
MLGEIVKYLFEQYGKGRKPTVGLLESTLFTGWMPTIFRAGRGMTLWEKAKRDPPPKKLEL
YSYENNPYARIVREALCELELPYILQNVGEGSLRSKSLDASGSKEVPYLIDPNTGTKVGD
YKKILSYLFQTYSAATV
Download sequence
Identical sequences M5XMB6
ppa013155m|PACid:17646628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]