SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa014715m|PACid:17646345 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa014715m|PACid:17646345
Domain Number 1 Region: 69-332
Classification Level Classification E-value
Superfamily Kelch motif 4.71e-49
Family Kelch motif 0.00058
Further Details:      
 
Weak hits

Sequence:  ppa014715m|PACid:17646345
Domain Number - Region: 17-98
Classification Level Classification E-value
Superfamily F-box domain 0.000567
Family F-box domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ppa014715m|PACid:17646345
Sequence length 366
Sequence
MSTSTTTTQSSSATEAQLIPSLPDDVALNCIARVPRWYYPTLSIVSRPIRSLLSSPLFFT
TRSLLSSTEHFLYLTLRLHHNPSAWFTLYQNPNPNNPNNPHVLIPVPPLPAPTVGAAYAV
VGPTIYVIGGSINDVPSSHVWVLDCRLHTWRKGPPMRVAREFSAAGVVDGKIYVIGGCVA
DSWARNEFWAESLDPGTGRWEAVRSPIDVRAKWMHASAVIGARVYAMADRGGVVLDPKAG
TWDVVDKRLDLGWRGRACVVHGILYCYDYLGKIRGFDVKKRVWKELKGLEKGLPKFLCGA
TMANVGEKLVVLWEGKGNGKEIEIWCAEIEVEKNGDGELQGKIGWSHKLISVPKNFSIVN
CLAVTL
Download sequence
Identical sequences M5W203
ppa014715m|PACid:17646345 XP_007206197.1.23749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]