SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa016885m|PACid:17662941 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa016885m|PACid:17662941
Domain Number 1 Region: 84-349
Classification Level Classification E-value
Superfamily Kelch motif 4.18e-20
Family Kelch motif 0.0082
Further Details:      
 
Weak hits

Sequence:  ppa016885m|PACid:17662941
Domain Number - Region: 11-86
Classification Level Classification E-value
Superfamily F-box domain 0.00111
Family F-box domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ppa016885m|PACid:17662941
Sequence length 382
Sequence
MDQEAIPKPKHEKHNQTQASSNETSLLSGLPNHLAQLCLAKINPSILFSVCHSWRRLIYS
PSFTPFFSLYALLSPPPDHSPNSPIQFSSLDPISNTWTSLPSPPSDPPLHLLHRHPAFLS
RKLPIQTLSVSGCLVLVAATTHQFTPALPRPLVFQPLSKQWSFGPALPKPRRFCAAGTVG
GKVYVASGMGTTYRGDVARSMEEWDMKGKEVSASWVKKAGLKDGRFSREAVEAIGYRGKL
WMVNVKGNAIKEGAVYDVETDTWQDMPQGMLGGWNGPTATSINDDDHHHDHDAMYVVDES
KGVLSKYVDENDCWEVVMDSVVLKEAEQVCAGRGRVCVVCANGTRIVVVDVVAPLPRIWV
AEPPPMLEVVAVHILPRMCRLD
Download sequence
Identical sequences M5XFV2
XP_007219189.1.23749 ppa016885m|PACid:17662941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]