SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa017665m|PACid:17653419 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa017665m|PACid:17653419
Domain Number 1 Region: 9-210
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.75e-31
Family PDI-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ppa017665m|PACid:17653419
Sequence length 212
Sequence
MAGTKKKFVEIDIIADTVCPWCFVGKRNLDKALEEGNDRYEFELRWHPFQIDPEIPKEGT
YKKEFYDTKMGADVAEVFETRMADIFSNHDMTYKIDGLTGNTIESHRLIYFAGLQDRDKQ
HDLVDEICLGYFTDGRFIGDRDYLLKCAEKIEIEGAAEFLDDPNNGLTEVKEELKKYSEV
KGIPYFVINGKEEFAGAQPTEVFLAAFEAATK
Download sequence
Identical sequences M5WU93
XP_007216055.1.23749 ppa017665m|PACid:17653419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]