SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa017848m|PACid:17652841 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa017848m|PACid:17652841
Domain Number 1 Region: 63-186
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 8.11e-22
Family alpha-D-mannose-specific plant lectins 0.0072
Further Details:      
 
Weak hits

Sequence:  ppa017848m|PACid:17652841
Domain Number - Region: 150-223
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000116
Family alpha-D-mannose-specific plant lectins 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ppa017848m|PACid:17652841
Sequence length 249
Sequence
MACLLLALTFVAAEAQQMQSNISRGSSLTPTTNTTWLSRSGLYAFGFYRQGNGYAVGIFL
AGISQKTVVWTANRDEPPVSNNATLLFTGDGLALPTAEGQNYLVKSSGSSSYASMLDSGN
FVLYNSGREIVWQSFDHPTDTLLPGQCLLSGNELFSANSEADHSTGIFRLKMQNDGNLVQ
YPVAAADTSIYAFYSSSTGGVFNSRWVLLHEKGSDVMVSFSNSIFLALVTEISCGYKLTL
AHLHRCTPV
Download sequence
Identical sequences M5W1F1
ppa017848m|PACid:17652841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]