SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa018529m|PACid:17644272 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa018529m|PACid:17644272
Domain Number 1 Region: 97-225
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.73e-19
Family Glutathione peroxidase-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ppa018529m|PACid:17644272
Sequence length 241
Sequence
MAASVNNIAATFATVPKTSSPSSSSSSSNPHQTKLSLSLSHKSISTPWNLHKTLPRSQRS
SLLNLYGPPGPPPNGSISTVHPRPLMITPKPSRPFSVCIGDKLPNITLSYLDPNDGAKLI
SLSTLCKGKRVVLVGVSAPFSPHCTRFMKRVESARGKSSDLIACVAASDVFVMRAWGENL
AVGDRVMMLSDGRGELGNALGVSLNLNTTTNACLVTFNGVIKSVEFDKEEGSLVATKSMA
H
Download sequence
Identical sequences M5Y1D9
ppa018529m|PACid:17644272 XP_007224266.1.23749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]