SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa018756m|PACid:17646889 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa018756m|PACid:17646889
Domain Number 1 Region: 56-167
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.96e-24
Family alpha-D-mannose-specific plant lectins 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ppa018756m|PACid:17646889
Sequence length 253
Sequence
QGYKPFPNYSLAEYDATYRVLNVSNYPFQLCLYNTIPNTFTLGLQMGNFFKYSKPPLHWV
WEPNRGNPVGENATLAFETDGNLVLVDADGRVAWQTNTENKGVVGLKLLPTSKMVLYNSK
ANFIWQSVDYPTDTLLVGQSLKVRSKHKLISLVLEPKGLVMYYKSKNSPKPLPYLNMKSD
MTGSWDHMTLNCTPDTYEGHAYDINLHQVQANSSYATKFLLARPKYNSILSFFRLEIDGN
LRIYIYYDDVNVS
Download sequence
Identical sequences M5WKX2
ppa018756m|PACid:17646889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]