SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa020121m|PACid:17640511 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa020121m|PACid:17640511
Domain Number 1 Region: 80-153
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.14e-24
Family Thioltransferase 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ppa020121m|PACid:17640511
Sequence length 153
Sequence
MATITDSIVLYSSAQNSYLRPVISSRPALSISVRRRLGALPEFRGLRVHLLPKPSPAPSN
FPKARPFPSTAGIVSQAQDTTLDVPTVTDRTWNSLVLKADGPVLVEFWAPWCGPCRTIHP
VVGELAKEYAGKLKCFKLSTDDTPSIATQYGIR
Download sequence
Identical sequences M5VHC7
ppa020121m|PACid:17640511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]