SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa020135m|PACid:17656606 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa020135m|PACid:17656606
Domain Number 1 Region: 70-343
Classification Level Classification E-value
Superfamily Kelch motif 4.05e-24
Family Kelch motif 0.0057
Further Details:      
 
Weak hits

Sequence:  ppa020135m|PACid:17656606
Domain Number - Region: 19-64
Classification Level Classification E-value
Superfamily F-box domain 0.00131
Family F-box domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ppa020135m|PACid:17656606
Sequence length 376
Sequence
MADSSRSPTKRPRLSQNDVVGHGHQPLLPGLPDDIAQVCLSLVHPSVLFSVCTSWRRLIY
SSSFPPFLSLYALLTSSSSPNSIQFYSFDPLSSNWHALPATPPDPPLRLFLRHPSFISRN
LPIQSVSVSGNLVLVAATTSNLLPALPRPLVFDPVAKKWAFGPPLATPRRWCSAGALGGA
VYVASGIGSHFSIDVARSVEKWDLTKNKKHPNDHLGWEWEKARGLRDGRFSRDAIEAVGW
RGKLCMVNLKGDAVKEGLMYDVEKDTWQDMPEGMIGGWKGPVAAMDEEVMYVVDEAKGAL
RRYNPEKDVWVEILESERLIGADQIAGGGGRVCVVCRGKILVVDVTAAPPSFRDVKTPLG
LEAVAIHILPRMSHAV
Download sequence
Identical sequences M5WZH1
ppa020135m|PACid:17656606 XP_007211021.1.23749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]