SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa020739m|PACid:17667996 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa020739m|PACid:17667996
Domain Number 1 Region: 230-319
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.64e-19
Family Thioltransferase 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ppa020739m|PACid:17667996
Sequence length 376
Sequence
MKGVKGKFLKKLKSIRPVGYLKPQDRILQVSASDGYADSYPKISDLNVQAQLVSMETEQK
KMKENVLTEQEPDVIDVDELMKDLEDEESGSEDDLDDKENIRPKMKAKNSMAFKENLMRT
EHNLGENRALEASEESLPGPDRGRQIPLSEIDISSFRRPDLNSGSLFDPNLLAAFQQAVM
EYMKLSEAERISRRSEKQNLDSNVVEPEPEPPSNEEPLLCFEEKCVPGSSDSSVILYSTT
LRGIRKTFDDCNSVRFLLESFRVVFYERDVSMHMEFREELWQVLDCKAVPPKLFIKGRYI
GGAEEVLTLHEQGKLKPLFHGVPIDRSIGPCEACDGVRFVVCFKCSGSCKVIGQEGQSDK
CSVCNENGLIICPLCC
Download sequence
Identical sequences M5X4M6
XP_007212831.1.23749 ppa020739m|PACid:17667996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]