SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa021003m|PACid:17644150 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa021003m|PACid:17644150
Domain Number 1 Region: 234-327,369-462
Classification Level Classification E-value
Superfamily TPR-like 1.4e-25
Family Tetratricopeptide repeat (TPR) 0.0039
Further Details:      
 
Domain Number 2 Region: 516-700
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.49e-25
Family Thioltransferase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ppa021003m|PACid:17644150
Sequence length 707
Sequence
MPHTTGKSMQEMGFDSLTSRFRDSLSYNSDTNNKNKPDFKELDLGSPVSCSSGTSSGSVS
SKTSNAQLGKRSDSKSNNHSGELSVSSETSPRASETGRSGTTPRNWKPAHRRSVSAGPPL
IYSGGSVNTCISTNASTNTATSSSSSTSIVSTTTVFPSGNICPSGKITKSGLACRASNKT
DVLGSGCGNYGHGSIVRGGGVKLDSNVNTSGGSNANVQLGGESVMGKRAMGNSDPEEVKK
AGNELYRRGHFGEALALYDRAISLSPENAAYRSNRAAALTVLGRLPEAVRECEEAVRLDP
GYGRAHQRLGSLYLRFGQVEKSYRHLCIPGQQPDQSELQKLKSLEKHLKQCEDARKLGDW
KSVLRESEAAIATGAESSPQLVACKAEALLKLHQLEDAESSLTNTPKFENYPSSCLPTKF
FGILIEAYVLYVRAQVEMALGRFENAVVAAEKAGLIDCSNVEVMRVSNKVKKVANARSQG
NDLFSSGRFAEACSAYGEGLKYDSSNSVLYCNRAVCRSKLGQWEQSVEDCNQALKIQPNY
IKALLRRAVSNAKLDRWAEAVRDYEVLRRDLPGDNEVAESLHRAQVALKKSHGEELHNVK
FGSEVEEVSSLDKFKAAISSPGVSVVHFKVESNEKCEEISPFINMLCVRYPYVNFFKVDV
EESLSIAKAESIRTIPTFKIYKNGEKVKEMVRPSHQFLEDSVRTCSL
Download sequence
Identical sequences M5WNW0
ppa021003m|PACid:17644150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]