SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa021090m|PACid:17655215 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa021090m|PACid:17655215
Domain Number 1 Region: 182-456
Classification Level Classification E-value
Superfamily Mitochondrial carrier 2.09e-80
Family Mitochondrial carrier 0.0000327
Further Details:      
 
Domain Number 2 Region: 11-176
Classification Level Classification E-value
Superfamily EF-hand 2.27e-31
Family Calmodulin-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ppa021090m|PACid:17655215
Sequence length 465
Sequence
MDHVLLALGETKEQRELRIRSLFNFFDTASIGYLDYTLIEAALSALQIPSEYKYAKDLLN
VCDANQDGRVDYQEFKRYMDDKELELYCIFQAIDVEHNGCILPEELWDALVRAGIEIDDE
ELARFVERVDKDNNGVITFEEWRDFLLLFPHEATIENIYHYLERVCLVDIGEQTVIPEVI
SKHVHASRYLIAGAVAGATSRTATAPLDRLKVVLQVQTKQARIMPAIRDIFREGGLLGFF
RGNGLNVLKVAPESAIRFYTYEMLKNFIVHANGEEDQANIGTATRLVSGGLAGAVAQTVI
YPMDLVKTRIQTYAGEGGRIPSLGNLSREIWVQEGSRAFYRGLVPSLLGIVPYAGIDLAA
YETLKDMSKKYILHDGEPGPLVQLGCGTVSGALGATCVYPLQVVRTRMQAHTAYKGMGDV
FRRTFQHEGLRGFYKGIFPNLLKVVPSASITYMVYESMKKSLDLG
Download sequence
Identical sequences M5WY19
ppa021090m|PACid:17655215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]