SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa021192m|PACid:17640945 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa021192m|PACid:17640945
Domain Number 1 Region: 81-345
Classification Level Classification E-value
Superfamily Kelch motif 1.57e-20
Family Kelch motif 0.0022
Further Details:      
 
Weak hits

Sequence:  ppa021192m|PACid:17640945
Domain Number - Region: 45-73
Classification Level Classification E-value
Superfamily F-box domain 0.00632
Family F-box domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ppa021192m|PACid:17640945
Sequence length 385
Sequence
MDQEAIPKPKHCRTQASSDETLLLPGLPNHLAQLCLAKINPSVLFSVCRSWRRLIYSPSF
PPFFSLYAILSPPPPHHHHHNPNSPIQFSSLDPISNTWTSLPPPPSSPPLQLLHCHPSFL
SRKLPIQWLSVSGRLVLVAATTHQFTPAMPRPLVFQPLSNQWSFGPPLPEPRRWCGVGTV
GGKVYVASGIGTTYRGDVARSMEEWDTKRKEASSSWVKKACLKDGRFSREDVEAIGYRGK
LWMVNSKGNAVKEGVVYDVQKDTWQVMPQGMLGGWNGPAAATINDDGHDDHDDDDVMYVV
DERKGVLNKYVDENDCWEMVMESVVLREAEQVCAGRGRVCVVCANGRRIVVVDVVATPPR
IWVVEPPPMLEVVAVHILPRMCRTD
Download sequence
Identical sequences M5XNN0
ppa021192m|PACid:17640945 XP_007219456.1.23749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]