SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa021380m|PACid:17664911 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa021380m|PACid:17664911
Domain Number 1 Region: 177-281
Classification Level Classification E-value
Superfamily TPR-like 1.19e-17
Family Tetratricopeptide repeat (TPR) 0.0024
Further Details:      
 
Domain Number 2 Region: 64-138
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000581
Family Thioredoxin-like 2Fe-2S ferredoxin 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ppa021380m|PACid:17664911
Sequence length 294
Sequence
MEVVVLPLPGSGSNNKSLCGLSSSTAAATSYFRRRRIVAITNSTINGSHSSSSAEAEEDI
QIKEIRVCTNRTCRRQGSFQTLDTLTALAPSNVAVKSSGCLGRCGAGPNLVALPAATLVA
HCGTTARAVEVLVALVLLSRRRGGGVSNSDGANANKNIETIANKSLEALALRNKARNELL
HNNNFSQAEFFLSQAIELKPIGGIHIMYKDRSLARLALGNYSGALEDAAQALALNPLYPE
AYICQGDAFLALNQFQSAHNSYMASLEIDPSLRRSKSFKARIANLEKLTTGNMP
Download sequence
Identical sequences M5WRL6
XP_007210749.1.23749 ppa021380m|PACid:17664911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]