SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa021758m|PACid:17654403 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa021758m|PACid:17654403
Domain Number 1 Region: 67-172
Classification Level Classification E-value
Superfamily Kelch motif 0.00000000301
Family Kelch motif 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ppa021758m|PACid:17654403
Sequence length 221
Sequence
MTSAKHTSTCSVLICVGLLGLALIADFLWASSPRFANSYISIASNWLLPLIFQNPCFCGF
RRANSPPLLWVFLLHVNSYRRFVKHFLLATLADLPGPELKWEKMADAPVARLDGAAIQIK
NLLFVFAGYSTIDYVHSHVDIYNFSDNTWGGRFDMPKEMAHSNLGMVTDGRISTSCNGEV
DHWSLAVKDGKALGKGWRTEIPIPRGGPHRSVHCLILALFM
Download sequence
Identical sequences M5XPS5
ppa021758m|PACid:17654403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]