SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ppa021899m|PACid:17641674 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa021899m|PACid:17641674
Domain Number 1 Region: 169-264
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.93e-25
Family B3 DNA binding domain 0.00034
Further Details:      
 
Domain Number 2 Region: 43-99
Classification Level Classification E-value
Superfamily DNA-binding domain 0.0000000000000386
Family GCC-box binding domain 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ppa021899m|PACid:17641674
Sequence length 370
Sequence
MEEGMSSTVSNSGMKMNTVGGVSDSSLAANDSTDGACKRVSKKFKGVVEQPNGHWGAQIY
ANHERVWLGTFNSEIDAAMGYDSAALKLRGRDCHRNFPWTETTFEEQHFQNQYATEVVLI
MIKDGSYQTKFSEFRRSRSGIESVGADVQFGSLARVQSSNGKGELLEDFLFQKELTPSDV
GKLNRLVIPSKYACTYFPTVSEAIRGKVESCSSQLTFYDRMMRSWTFRFCFWKSSKSFVF
TKGWSRFVRTHDLQAKDTIRFLQCQYKQSGDGNYKEQPHSFCMIQVKKDGGRSNDVSCLV
ENNANSYQYDGVRNDGGMMDSDYKFKVEAVSPNIHEDEDGILLADEKKCFRLFGVEISDV
DVLSSHSIIV
Download sequence
Identical sequences M5VTE8
ppa021899m|PACid:17641674 XP_007203443.1.23749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]