SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa022700m|PACid:17644290 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa022700m|PACid:17644290
Domain Number 1 Region: 85-205
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 7.98e-19
Family alpha-D-mannose-specific plant lectins 0.0053
Further Details:      
 
Weak hits

Sequence:  ppa022700m|PACid:17644290
Domain Number - Region: 359-396
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00471
Family Pan module (APPLE domain) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ppa022700m|PACid:17644290
Sequence length 472
Sequence
MQLYLFISLSLFFTYGHSKTDISLGYQLTVAVPIEYSLGFIGRAFLMETNEITPTFKTAL
SVEAVNDKYSCSLEVFLGDVKVWNSGHYSKFYTSNICVLQLTQDGDLKLKGPKDRVGWRT
GTSGQGVQRLEILRTGNLVLLDGLGNIKWQSFNFPTDVMLWGQRLSVASRLISFPTNSTS
YYSLEIEQSRIALYLNSGKWNYSYWEFKPTKNRNIAYVQLGRKGLELFNDKLKKIAQIHP
SDHQTVQFGQPLRFLALGNRTGNLKLYFYSPSIAKFDVAFQALNTTCDLPLACKPYGICT
LSSACSCIQVLIAENETSISGNSDCSQGISGVCGNGKTKAEMLELKGVGSVLRGAPKIVN
VSKEACANLCLEDCNCTSALYSTAKGGMEVEECFLYGMVIGVKQVERGSGLSYMVKVRKG
AHGGHGKSNLKRWVLVLVGVVDGLIILLVFGGLGYYLIKKRRKQTLPNGHNN
Download sequence
Identical sequences M5W533
XP_007207663.1.23749 ppa022700m|PACid:17644290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]