SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa024332m|PACid:17650397 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa024332m|PACid:17650397
Domain Number 1 Region: 96-191
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.64e-20
Family Thioltransferase 0.02
Further Details:      
 
Weak hits

Sequence:  ppa024332m|PACid:17650397
Domain Number - Region: 198-243
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0239
Family Growth factor receptor domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ppa024332m|PACid:17650397
Sequence length 247
Sequence
MWRPWGKSTVQIHNTSSPSSPFSFSSFKDIQNLCADENEHSQQPTNAAARRTSAIFHRVR
VANSLLRAWSTRPPTQPQDENSAKQSEPSISSIPGAEKRIVVYFTSLRVVRPTFEDCRTV
RSILRGFRVSLDERDLAMDHGFLTELQQILGQHTKLTLPRVFIGGRYIGGADEVRTLHET
GELKKFVEGLPAQEPGVCDTCGGYRFILCVECSGSHKLYTEKNGFKSCTSCNENGLIRCP
SCSCAPL
Download sequence
Identical sequences M5WSW7
XP_007208696.1.23749 ppa024332m|PACid:17650397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]