SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa024396m|PACid:17651375 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa024396m|PACid:17651375
Domain Number 1 Region: 76-195
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000000000432
Family alpha-D-mannose-specific plant lectins 0.0061
Further Details:      
 
Weak hits

Sequence:  ppa024396m|PACid:17651375
Domain Number - Region: 349-387
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000112
Family Anti-platelet protein 0.085
Further Details:      
 
Domain Number - Region: 208-266
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0275
Family alpha-D-mannose-specific plant lectins 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ppa024396m|PACid:17651375
Sequence length 487
Sequence
LLLITLTLLLYTPTWPSSAAAPQTELLRDFKATPDPSIQTFQSLLADPNGNFSLGFLRVN
KTQLALALLHVPSSDPLWLANPAQLARWSDRTTLVFNGSLVLSDPQGRVFWSTHTQGDRV
VLLNTSNVQVQTQSSVLWQSFDFPTNILVENQNFTSTMSLVSSNGLYSMRLGNNFMGLYA
KFKSGSNSDQIYWRHRAMEVKAEIVEGRGPIYAQVNSDGFLGMYQTGNSAPVDIQPFNTF
HRPVNGLRKVRLEPDGNFNGFYWDGSKWVPDFQAISLPCELPSPCGAYGLCGAGNGSCFC
LDNRTEFRSGECFPVQNGDFCRSGLGEISNFWVIRRSGVELPYKELMGYQTTSSYGECER
VCERNCSCWGAVYNNASGFCYTMDYPIQTLVGVGDESKMGYFKVREGAGRKKMNVGFGVG
IGVVCGALVIFVGVAGVWSFRARRRKRGRGGGGVKRFTGQDGGLSPGPYKDLGSASFGSI
EMGNNSR
Download sequence
Identical sequences M5VTG3
ppa024396m|PACid:17651375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]