SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppb013122m|PACid:17641992 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppb013122m|PACid:17641992
Domain Number 1 Region: 80-157
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.68e-18
Family Thioltransferase 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ppb013122m|PACid:17641992
Sequence length 176
Sequence
MGGSVKVSQSKKVVWPSSCEASKHMDEDGKVADTLEGADPSSLANKVAVEPEEPAPELTK
ENESSQEQIQVQDGLDDALKRRLQQLIESNRVMLFMKGTPEDPKCEFSKMAVNMLKIYEV
EFGSFDLLTDNEVMEGIQKYSNWPLLPHIYFEGRACGFRHIGTLMKGCPSDPTAFG
Download sequence
Identical sequences M5X8W1
ppb013122m|PACid:17641992 XP_007214296.1.23749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]